HMBS Rabbit mAb, Clone: [ARC0685], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11701S
Article Name: HMBS Rabbit mAb, Clone: [ARC0685], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11701S
Supplier Catalog Number: CNA11701S
Alternative Catalog Number: MBL-CNA11701S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HMBS (P08397).
Conjugation: Unconjugated
Alternative Names: UPS, PBGD, PORC, PBG-D
Clonality: Monoclonal
Clone Designation: [ARC0685]
Molecular Weight: 39kDa
NCBI: 3145
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNI
Target: HMBS
Application Dilute: WB: WB,1:500 - 1:2000