NUR77 Rabbit mAb, Clone: [ARC0686], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11703S
Article Name: |
NUR77 Rabbit mAb, Clone: [ARC0686], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA11703S |
Supplier Catalog Number: |
CNA11703S |
Alternative Catalog Number: |
MBL-CNA11703S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUR77 (P22736). |
Conjugation: |
Unconjugated |
Alternative Names: |
HMR, N10, TR3, NP10, GFRP1, NAK-1, NGFIB, NUR77 |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0686] |
Molecular Weight: |
64kDa |
NCBI: |
3164 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASAS |
Target: |
NR4A1 |
Application Dilute: |
WB: WB,1:500 - 1:2000 |