NUR77 Rabbit mAb, Clone: [ARC0686], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11703S
| Article Name: |
NUR77 Rabbit mAb, Clone: [ARC0686], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11703S |
| Supplier Catalog Number: |
CNA11703S |
| Alternative Catalog Number: |
MBL-CNA11703S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUR77 (P22736). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HMR, N10, TR3, NP10, GFRP1, NAK-1, NGFIB, NUR77 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0686] |
| Molecular Weight: |
64kDa |
| NCBI: |
3164 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASAS |
| Target: |
NR4A1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
