P2RX5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11710T
Article Name: P2RX5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11710T
Supplier Catalog Number: CNA11710T
Alternative Catalog Number: MBL-CNA11710T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2).
Conjugation: Unconjugated
Alternative Names: P2X5, LRH-1, P2X5R
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 5026
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Target: P2RX5
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200