PPP5C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11712T
Article Name: PPP5C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11712T
Supplier Catalog Number: CNA11712T
Alternative Catalog Number: MBL-CNA11712T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human PPP5C (NP_006238.1).
Conjugation: Unconjugated
Alternative Names: PP5, PPT, PPP5
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 5536
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY
Target: PPP5C
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200