SPTLC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11716T
Article Name: SPTLC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11716T
Supplier Catalog Number: CNA11716T
Alternative Catalog Number: MBL-CNA11716T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 423-562 of human SPTLC2 (NP_004854.1).
Conjugation: Unconjugated
Alternative Names: LCB2, SPT2, HSN1C, LCB2A, NSAN1C, hLCB2a
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 9517
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETED
Target: SPTLC2
Application Dilute: WB: WB,1:500 - 1:2000