NACC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11720T
Article Name: NACC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11720T
Supplier Catalog Number: CNA11720T
Alternative Catalog Number: MBL-CNA11720T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1).
Conjugation: Unconjugated
Alternative Names: NAC1, BEND8, NAC-1, NECFM, BTBD30, BTBD14B
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 112939
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL
Target: NACC1
Application Dilute: WB: WB,1:500 - 1:2000