GLUT1/SLC2A1 Rabbit mAb, Clone: [ARC0304], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11727S
Article Name: GLUT1/SLC2A1 Rabbit mAb, Clone: [ARC0304], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11727S
Supplier Catalog Number: CNA11727S
Alternative Catalog Number: MBL-CNA11727S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 393-492 of human GLUT1/SLC2A1 (P11166).
Conjugation: Unconjugated
Alternative Names: CSE, PED, DYT9, GLUT, DYT17, DYT18, EIG12, GLUT1, HTLVR, GLUT-1, SDCHCN, GLUT1DS
Clonality: Monoclonal
Clone Designation: [ARC0304]
Molecular Weight: 54kDa
NCBI: 6513
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Target: SLC2A1
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200