Connexin 43 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11752P
Article Name: Connexin 43 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11752P
Supplier Catalog Number: CNA11752P
Alternative Catalog Number: MBL-CNA11752P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 233-382 of human Connexin 43 (NP_000156.1).
Conjugation: Unconjugated
Alternative Names: HSS, CMDR, CX43, EKVP, GJAL, ODDD, AVSD3, EKVP3, HLHS1, PPKCA
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 2697
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Target: GJA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200