RUNX2 Rabbit mAb, Clone: [ARC0362], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11753S
| Article Name: |
RUNX2 Rabbit mAb, Clone: [ARC0362], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11753S |
| Supplier Catalog Number: |
CNA11753S |
| Alternative Catalog Number: |
MBL-CNA11753S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 336-439 of human RUNX2 (Q13950). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0362] |
| Molecular Weight: |
57kDa |
| NCBI: |
860 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
PRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQT |
| Target: |
RUNX2 |
| Application Dilute: |
WB: WB,1:100 - 1:500|IP,1:100 - 1:500 |
