TLR3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11778P
Article Name: TLR3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11778P
Supplier Catalog Number: CNA11778P
Alternative Catalog Number: MBL-CNA11778P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human TLR3 (NP_003256.1).
Conjugation: Unconjugated
Alternative Names: CD283, IIAE2, IMD83
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 7098
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA
Target: TLR3
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200