NOXA2/p67phox Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1178S
Article Name: NOXA2/p67phox Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1178S
Supplier Catalog Number: CNA1178S
Alternative Catalog Number: MBL-CNA1178S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 227-526 of human NOXA2/p67phox (NP_000424.2).
Conjugation: Unconjugated
Alternative Names: NCF-2, NOXA2, P67PHOX, P67-PHOX
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 4688
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQE
Target: NCF2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200