DNMT3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11791T
Article Name: DNMT3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11791T
Supplier Catalog Number: CNA11791T
Alternative Catalog Number: MBL-CNA11791T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A (NP_715640.2).
Conjugation: Unconjugated
Alternative Names: TBRS, HESJAS, DNMT3A2, M.HsaIIIA
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 1788
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLL
Target: DNMT3A
Application Dilute: WB: WB,1:500 - 1:2000