RAB5A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1180T
Article Name: RAB5A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1180T
Supplier Catalog Number: CNA1180T
Alternative Catalog Number: MBL-CNA1180T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human RAB5A (NP_004153.2).
Conjugation: Unconjugated
Alternative Names: RAB5
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 5868
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Target: RAB5A
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200