ISG15 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1182P
Article Name: ISG15 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1182P
Supplier Catalog Number: CNA1182P
Alternative Catalog Number: MBL-CNA1182P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1).
Conjugation: Unconjugated
Alternative Names: G1P2, IP17, UCRP, IFI15, IMD38, hUCRP
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 9636
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Target: ISG15
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200