ASMT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11840T
Article Name: ASMT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11840T
Supplier Catalog Number: CNA11840T
Alternative Catalog Number: MBL-CNA11840T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 76-298 of human ASMT (NP_001164510.1).
Conjugation: Unconjugated
Alternative Names: ASMTY, HIOMT, HIOMTY
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 438
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
Target: ASMT
Application Dilute: WB: WB,1:500 - 1:2000