Calmodulin 1/2/3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1185P
Article Name: Calmodulin 1/2/3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1185P
Supplier Catalog Number: CNA1185P
Alternative Catalog Number: MBL-CNA1185P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin 1/2/3 (NP_008819.1).
Conjugation: Unconjugated
Alternative Names: CALM1,CALML2,CAMI,CPVT4,DD132,LQT14,PHKD,caM
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 801
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target: CALM1
Application Dilute: WB: WB,1:500 - 1:1000