GGA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1186S
Article Name: GGA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1186S
Supplier Catalog Number: CNA1186S
Alternative Catalog Number: MBL-CNA1186S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GGA2 (NP_055859.1).
Conjugation: Unconjugated
Alternative Names: VEAR
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 23062
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRR
Target: GGA2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200