S6 Ribosomal Protein (RPS6) Rabbit mAb, Clone: [ARC50655], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11874P
Article Name: S6 Ribosomal Protein (RPS6) Rabbit mAb, Clone: [ARC50655], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11874P
Supplier Catalog Number: CNA11874P
Alternative Catalog Number: MBL-CNA11874P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2).
Conjugation: Unconjugated
Alternative Names: S6, eS6
Clonality: Monoclonal
Clone Designation: [ARC50655]
Molecular Weight: 29kDa
NCBI: 6194
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP
Target: RPS6
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200