MMP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1191P
Article Name: MMP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1191P
Supplier Catalog Number: CNA1191P
Alternative Catalog Number: MBL-CNA1191P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1).
Conjugation: Unconjugated
Alternative Names: CLG, CLGN
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 4312
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
Target: MMP1
Application Dilute: WB: WB,1:500 - 1:1000