beta-Catenin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11932S
Article Name: beta-Catenin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11932S
Supplier Catalog Number: CNA11932S
Alternative Catalog Number: MBL-CNA11932S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (NP_001895.1).
Conjugation: Unconjugated
Alternative Names: EVR7, CTNNB, MRD19, NEDSDV, armadillo
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 1499
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Target: CTNNB1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100