JunD Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11955T
Article Name: JunD Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11955T
Supplier Catalog Number: CNA11955T
Alternative Catalog Number: MBL-CNA11955T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3).
Conjugation: Unconjugated
Alternative Names: AP-1
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 3727
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPE
Target: JUND
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100