PDGFB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1195P
Article Name: PDGFB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1195P
Supplier Catalog Number: CNA1195P
Alternative Catalog Number: MBL-CNA1195P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 142-241 of human PDGFB (NP_002599.1).
Conjugation: Unconjugated
Alternative Names: SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 5155
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Target: PDGFB
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200