JAK1 Rabbit mAb, Clone: [ARC0434], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11963S
Article Name: JAK1 Rabbit mAb, Clone: [ARC0434], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11963S
Supplier Catalog Number: CNA11963S
Alternative Catalog Number: MBL-CNA11963S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human JAK1 (P23458).
Conjugation: Unconjugated
Alternative Names: JTK3, AIIDE, JAK1A, JAK1B
Clonality: Monoclonal
Clone Designation: [ARC0434]
Molecular Weight: 133kDa
NCBI: 3716
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLAS
Target: JAK1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200