FHIT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1196S
Article Name: FHIT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1196S
Supplier Catalog Number: CNA1196S
Alternative Catalog Number: MBL-CNA1196S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-147 of human FHIT (NP_001159715.1).
Conjugation: Unconjugated
Alternative Names: FRA3B, AP3Aase
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 2272
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
Target: FHIT
Application Dilute: WB: WB,1:500 - 1:2000