PGC1alpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11971P
Article Name: PGC1alpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11971P
Supplier Catalog Number: CNA11971P
Alternative Catalog Number: MBL-CNA11971P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-798 of human PGC1alpha (NP_037393.1).
Conjugation: Unconjugated
Alternative Names: LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1(alpha)
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 10891
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Target: PPARGC1A
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200