SLC5A1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11976P
| Article Name: |
SLC5A1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11976P |
| Supplier Catalog Number: |
CNA11976P |
| Alternative Catalog Number: |
MBL-CNA11976P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC5A1 (NP_000334.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NAGT, SGLT1, SGLT-1, D22S675 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
73kDa |
| NCBI: |
6523 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG |
| Target: |
SLC5A1 |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
