IGF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11985S1
Article Name: IGF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11985S1
Supplier Catalog Number: CNA11985S1
Alternative Catalog Number: MBL-CNA11985S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1).
Conjugation: Unconjugated
Alternative Names: IGF, MGF, IGFI, IGF-I
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 3479
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN
Target: IGF1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100