BYSL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11993T
Article Name: BYSL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11993T
Supplier Catalog Number: CNA11993T
Alternative Catalog Number: MBL-CNA11993T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BYSL (NP_004044.3).
Conjugation: Unconjugated
Alternative Names: Enp1, BYSTIN
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 705
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HAEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL
Target: BYSL
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100