CAPN3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11995T
Article Name: CAPN3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11995T
Supplier Catalog Number: CNA11995T
Alternative Catalog Number: MBL-CNA11995T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CAPN3 (NP_775111.1).
Conjugation: Unconjugated
Alternative Names: p94, CANP3, LGMD2, nCL-1, CANPL3, LGMD2A, LGMDD4, LGMDR1
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 825
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA
Target: CAPN3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200