HR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11996T
Article Name: HR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11996T
Supplier Catalog Number: CNA11996T
Alternative Catalog Number: MBL-CNA11996T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-480 of human HR (NP_005135.2).
Conjugation: Unconjugated
Alternative Names: AU, MUHH, ALUNC, HYPT4, MUHH1, HSA277165
Clonality: Polyclonal
Molecular Weight: 127kDa
NCBI: 55806
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SLGSKGFYYKDPSIPRLAKEPLAAAEPGLFGLNSGGHLQRAGEAERPSLHQRDGEMGAGRQQNPCPLFLGQPDTVPWTSWPACPPGLVHTLGNVWAGPGDGNLGYQLGPPATPRCPSPEPPVTQRGCCSSYPPTKGGGLGPCGKCQEGLEGGASGASEPSEEVNKASGPRACPPSHHTKLKKTWLTRHSEQFECPRGCPEVEERPVARLRALKRAGSPEVQGAMGSPAPKRPPDPFPGTAEQGAGGWQEVRDTS
Target: HR
Application Dilute: WB: WB,1:500 - 1:1000