S100A8 Rabbit mAb, Clone: [ARC0478], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA12018S
| Article Name: |
S100A8 Rabbit mAb, Clone: [ARC0478], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA12018S |
| Supplier Catalog Number: |
CNA12018S |
| Alternative Catalog Number: |
MBL-CNA12018S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-93 of human S100A8 (P05109). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG, S100-A8 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0478] |
| Molecular Weight: |
11kDa |
| NCBI: |
6279 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Target: |
S100A8 |
| Application Dilute: |
WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200 |
