GLMN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12025T
Article Name: GLMN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12025T
Supplier Catalog Number: CNA12025T
Alternative Catalog Number: MBL-CNA12025T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 405-594 of human GLMN (NP_444504.1).
Conjugation: Unconjugated
Alternative Names: FAP, GVM, GLML, FAP48, FAP68, FKBPAP, VMGLOM
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 11146
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK
Target: GLMN
Application Dilute: WB: WB,1:500 - 1:2000