MYH10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12029T
Article Name: MYH10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12029T
Supplier Catalog Number: CNA12029T
Alternative Catalog Number: MBL-CNA12029T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1).
Conjugation: Unconjugated
Alternative Names: NMMHCB, NMMHC-IIB
Clonality: Polyclonal
Molecular Weight: 229kDa
NCBI: 4628
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
Target: MYH10
Application Dilute: WB: WB,1:500 - 1:2000