POLR1B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12034T
| Article Name: |
POLR1B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA12034T |
| Supplier Catalog Number: |
CNA12034T |
| Alternative Catalog Number: |
MBL-CNA12034T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 670-900 of human POLR1B (NP_061887.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
A135, RPA2, TCS4, RPA135, Rpo1-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
128kDa |
| NCBI: |
84172 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
IANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQSPLVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFIDLSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMYYKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAE |
| Target: |
POLR1B |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
