SYNPO Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12049T
Article Name: SYNPO Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12049T
Supplier Catalog Number: CNA12049T
Alternative Catalog Number: MBL-CNA12049T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human SYNPO (NP_001159680.1).
Conjugation: Unconjugated
Alternative Names: SYNPO
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 11346
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSLDLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK
Target: SYNPO
Application Dilute: WB: WB,1:500 - 1:2000