POLK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12052T
Article Name: POLK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12052T
Supplier Catalog Number: CNA12052T
Alternative Catalog Number: MBL-CNA12052T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1).
Conjugation: Unconjugated
Alternative Names: DINP, POLQ, DINB1
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 51426
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS
Target: POLK
Application Dilute: WB: WB,1:500 - 1:2000