MEF2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12059P
Article Name: MEF2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12059P
Supplier Catalog Number: CNA12059P
Alternative Catalog Number: MBL-CNA12059P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2A (NP_001124400.1).
Conjugation: Unconjugated
Alternative Names: mef2, ADCAD1, RSRFC4, RSRFC9
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 4205
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGRKKIQITRIMDERNRQTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Target: MEF2A
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200