OLR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12060T
Article Name: OLR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12060T
Supplier Catalog Number: CNA12060T
Alternative Catalog Number: MBL-CNA12060T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OLR1 (NP_002534.1).
Conjugation: Unconjugated
Alternative Names: LOX1, LOXIN, SLOX1, CLEC8A, SCARE1
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 4973
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESEN
Target: OLR1
Application Dilute: WB: WB,1:500 - 1:1000