GIGYF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12069T
Article Name: GIGYF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12069T
Supplier Catalog Number: CNA12069T
Alternative Catalog Number: MBL-CNA12069T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human GIGYF2 (NP_001096617.1).
Conjugation: Unconjugated
Alternative Names: GYF2, PERQ2, PERQ3, PARK11, TNRC15
Clonality: Polyclonal
Molecular Weight: 150kDa
NCBI: 26058
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTDRVGVASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPAKVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVS
Target: GIGYF2
Application Dilute: WB: WB,1:500 - 1:1000