STAT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12075T
Article Name: STAT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12075T
Supplier Catalog Number: CNA12075T
Alternative Catalog Number: MBL-CNA12075T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human STAT1 (NP_009330.1).
Conjugation: Unconjugated
Alternative Names: CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 6772
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Target: STAT1
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000