PKLR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12084T
Article Name: PKLR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12084T
Supplier Catalog Number: CNA12084T
Alternative Catalog Number: MBL-CNA12084T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1).
Conjugation: Unconjugated
Alternative Names: PK1, PKL, RPK, PKRL
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 5313
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
Target: PKLR
Application Dilute: WB: WB,1:500 - 1:2000