RAB21 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12095T
Article Name: RAB21 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12095T
Supplier Catalog Number: CNA12095T
Alternative Catalog Number: MBL-CNA12095T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human RAB21 (NP_055814.1).
Conjugation: Unconjugated
Alternative Names: RAB21
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 23011
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Target: RAB21
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200