Sec23A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12101T
Article Name: Sec23A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12101T
Supplier Catalog Number: CNA12101T
Alternative Catalog Number: MBL-CNA12101T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Sec23A (NP_006355.2).
Conjugation: Unconjugated
Alternative Names: CLSD, hSec23A
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 10484
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCMEDEDLQALKES
Target: SEC23A
Application Dilute: WB: WB,1:500 - 1:2000