NDUFA8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12118T
Article Name: NDUFA8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12118T
Supplier Catalog Number: CNA12118T
Alternative Catalog Number: MBL-CNA12118T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 33-172 of human NDUFA8 (NP_055037.1).
Conjugation: Unconjugated
Alternative Names: PGIV, CI-19KD, CI-PGIV, MC1DN37
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 4702
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Target: NDUFA8
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100