AIFM2/FSP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12128P
Article Name: AIFM2/FSP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12128P
Supplier Catalog Number: CNA12128P
Alternative Catalog Number: MBL-CNA12128P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 43-371 of human AIFM2/FSP1/AMID/AMID (NP_116186.1).
Conjugation: Unconjugated
Alternative Names: AMID, FSP1, PRG3
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 84883
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAY
Target: AIFM2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200