CA3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1212S
Article Name: CA3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1212S
Supplier Catalog Number: CNA1212S
Alternative Catalog Number: MBL-CNA1212S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CA3 (NP_005172.1).
Conjugation: Unconjugated
Alternative Names: Car3, CAIII
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 761
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRV
Target: CA3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200