SLC25A24 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12138T
Article Name: SLC25A24 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12138T
Supplier Catalog Number: CNA12138T
Alternative Catalog Number: MBL-CNA12138T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC25A24 (NP_037518.3).
Conjugation: Unconjugated
Alternative Names: APC1, SCAMC1, SCAMC-1
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 29957
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
Target: SLC25A24
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200