DNAJC10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12143T
Article Name: DNAJC10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12143T
Supplier Catalog Number: CNA12143T
Alternative Catalog Number: MBL-CNA12143T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 614-793 of human DNAJC10 (NP_061854.1).
Conjugation: Unconjugated
Alternative Names: JPDI, MTHr, ERdj5, PDIA19
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 54431
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Target: DNAJC10
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200