COPZ1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12148T
Article Name: COPZ1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12148T
Supplier Catalog Number: CNA12148T
Alternative Catalog Number: MBL-CNA12148T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human COPZ1 (NP_057141.1).
Conjugation: Unconjugated
Alternative Names: COPZ, CGI-120, HSPC181, zeta-COP, zeta1-COP
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 22818
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Target: COPZ1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200