DTL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12150T
Article Name: DTL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12150T
Supplier Catalog Number: CNA12150T
Alternative Catalog Number: MBL-CNA12150T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 541-730 of human DTL (NP_057532.3).
Conjugation: Unconjugated
Alternative Names: CDT2, RAMP, DCAF2, L2DTL
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 51514
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKTLPSPVTITPSSMRKICTYFHRKSQEDFCGPEHSTEL
Target: DTL
Application Dilute: WB: WB,1:500 - 1:2000